PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 898aa    MW: 99374.7 Da    PI: 6.5884
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00829.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.5e-27554604252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Pahal.C00829.1 554 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 604
                     8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961543624IPR003035RWP-RK domain
PfamPF020422.1E-23557604IPR003035RWP-RK domain
SuperFamilySSF542772.29E-23793888No hitNo description
SMARTSM006661.9E-25803885IPR000270PB1 domain
PROSITE profilePS5174519.68803885IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.3E-25804884No hitNo description
CDDcd064075.58E-33804884No hitNo description
PfamPF005641.7E-17804884IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    Send to blast
MEFDFDSPDG GDAWLLDAMA TSLHFSAASP PLWPCGDPHH SSVVPLDTAA PQDDAPGARS  60
GKSEITKKGE PINGKCQVHL SMVEDYSDSS YFLKERLTLA LRYFKESTNQ HLLVQVWVPI  120
RKGDRYMLST SGQPFVLDQR SIGLFQYRAV SMMYMFSVDG DNVKELGLPG RVYKQKVPEW  180
TPNVQYYSST EYARLNHAIS YNVHGTVALP VFDPSTKSCI AVVELIMTSK KVNYASEIGK  240
VSKALEAVNL KSTEVVEHPY VQIFNEGHQA TLVEMLEVLT VICEELKLPL AQTWVPCKYQ  300
NLLVPCGVKK SNFNIHGSCA QELCMSTSDV VFHVIDAHMW GFRDACVEHH LQKGQGVSGK  360
AFILRRPCFS KDVTRFSKME YPLVHYARMF GLAGCFSVCL QSAYTGNDDY VLEFFLPPDC  420
REDDEQKVLL ESILTLLRQH LHSLHVATDE GSNEELQVDA ITVIDNNETK DEYVQHPNFE  480
GGINASHESN AHGIHESDRQ KRIASSEYEM CLSPENSTKC NGKLFVGPNG GCTSDSLLPD  540
NNSKHHGRRR GKAEKTFSLE VIQHYFTGSL KNAAKSLGVC PTTMKRICRQ HGISRWPSRQ  600
ISKVNRSISK LKKVIESVEG SESAFTLTSI TGPLPVPFSP SNPINVKNGR QTEVTDLSIP  660
SVQENRGSSS QIKLLQNDDR LGMLIPQRSF LANISRQIEQ EKALNLRSSS GEPSTNSGTS  720
EDSCLGSPAN RTFVSTLMEQ QQNMGKPDRF TKGPFQTQDL LLPGLFVNGS GSSKNCKSHI  780
TAAVNEPAVV PLGSLMSVHN SGIVTVKARY KEDLLRFRFP CSASIIDLKD EVAKRIQIDV  840
GVFDIKYLDD DHEWVKLTCD ADLEECVEIS RLSGSNVLRL LVTDIAPILG SSCGSTG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960682.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3Z3P20.0K3Z3P2_SETIT; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein